PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_A014E9069.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 364aa    MW: 40518.3 Da    PI: 11.9712
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_A014E9069.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-1572119148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
  Traes_6DL_A014E9069.1  72 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 119
                            678*******************************************97 PP

2Myb_DNA-binding53.36.3e-17126170248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  Traes_6DL_A014E9069.1 126 GMFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 170
                            569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.81967119IPR017930Myb domain
SuperFamilySSF466891.52E-2869166IPR009057Homeodomain-like
SMARTSM007175.3E-1171121IPR001005SANT/Myb domain
PfamPF002491.5E-1372119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2173126IPR009057Homeodomain-like
CDDcd001679.30E-1075119No hitNo description
PROSITE profilePS5129425.123120174IPR017930Myb domain
SMARTSM007176.3E-14124172IPR001005SANT/Myb domain
PfamPF002492.4E-15126170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-25127173IPR009057Homeodomain-like
CDDcd001673.14E-11128170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MAIKLPPTAP LWKRQNAPPS PSQGLNPKPL PPPLPPVDLS EVSCRAAPVV RLQASKAMGC  60
KACDKPRPSY RKGLWSPEED QKLRDYILRH GHGCWSALPA KAGLQRNGKS CRLRWINYLR  120
PGLKHGMFSP EEEETVMSLH AALGNKWSRI ARHLPGRTDN EVKNYWNSYL KKRVEGGKEA  180
PGSPAPXXXX XXXXRVPEPE PRGSQYGAGT GRPAVELRLV GAAARVVVGR LELSDRDRAS  240
RLQGPRARDS QGDVRRLAQH GLHRWPGGGG GTWPGSRGGG WCRRRRSSSG DEPGVRAGRW  300
ATWRGGSPAR RLRRQRHLLG VPGAVRQHGS DAGRRRVLRP ALHDRVLRPQ LEHRQGIRRN  360
YRVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24681753109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387441e-145BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5GYC80.0W5GYC8_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-55myb domain protein 18
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]